how to write Fasta file for extracting multiple Sequences in python -


i want fasta file output this

>fragment 1 | description .... mvppppsr  >fragment 2 | description ... ggaakpgqlgr >fragment 3 | description .. slgplllllrpeepedgdr >fragment 4 | description . eicsesk 

but output show : assertionerror

python script

from bio import seqio bio.seq import seq bio.seqrecord import seqrecord bio.alphabet import iupac  example = 'mvppppsrggaakpgqlgrslgplllllrpeepedgdreicsesk'  def trypsin(bases):     sub = ''     while bases:         k, r = bases.find('k'), bases.find('r')         cut = min(k, r)+1 if k > 0 , r > 0 else max(k, r)+1         sub += bases[:cut]         bases = bases[cut:]         if not bases or bases[0] != 'p':             yield sub             sub = ''  seq = (list(trypsin(example))) y = '\n'.join(seq) print(y) my_seqs = seqrecord(seq(y,iupac.protein), id = "fragment_%i (i+1)",description="....") print (my_seqs) open("try.fasta", "w") handle:     seqio.write(my_seqs, handle, "fasta") 

i don't know what's wrong in script python. confuse please me thanks


Comments

Popular posts from this blog

angular - DownloadURL return null in below code -

python 2.7 - Given three nested dictionaries, sort the top two nested dictionaries from a value in the innermost dictionary? -